PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009257P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 476aa    MW: 52482.3 Da    PI: 8.2532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009257P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-1659105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede l +av+ + g++Wk+Ia+++   R++ qc +rwqk+l
   MELO3C009257P1  59 KGGWTPQEDETLRNAVAAFKGKNWKKIAEYFH-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding49.87.6e-16111150141
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 
                      +g+WT+eEd++++++v ++G+  W++Ia+ ++ gR +kqc+
   MELO3C009257P1 111 KGPWTQEEDDKIIELVSKYGPTKWSLIAKSLP-GRIGKQCR 150
                      79******************************.*******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.62554105IPR017930Myb domain
SuperFamilySSF466892.56E-1455108IPR009057Homeodomain-like
SMARTSM007179.7E-1458107IPR001005SANT/Myb domain
PfamPF002497.9E-1559105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2261112IPR009057Homeodomain-like
CDDcd001675.00E-1262105No hitNo description
SuperFamilySSF466891.49E-2091151IPR009057Homeodomain-like
PROSITE profilePS5129423.352106161IPR017930Myb domain
SMARTSM007179.1E-10110159IPR001005SANT/Myb domain
PfamPF002494.1E-15111151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-21113151IPR009057Homeodomain-like
CDDcd001677.07E-13113151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MEEAKQEECC LENKQSTAAT SSSVSEGSGS ATAKSPWMCS PASTSPSHRR TSGPIRRAKG  60
GWTPQEDETL RNAVAAFKGK NWKKIAEYFH DRSEVQCLHR WQKVLNPDLV KGPWTQEEDD  120
KIIELVSKYG PTKWSLIAKS LPGRIGKQCR ESSQNGARDT TKTPPTKRFP PYSSKGSDST  180
AQTSSGNTDL YKLDESCKDQ IESSAPPDED MIASTSGVLN ESADSRHVKR WAGPSNIMDP  240
RCRKSGTSRK NGTITHGEAE NEIGKFDEDK ILRTPSRFES PKYGSLYYEP PQLESSIPVD  300
SELLSMYMLE TNNSSITSPI GIFTPPCVKT RNLSIHSPES ILRIAARSFP STPSILRKRK  360
TETQACLPPK VMQDVESEAT VKDISREAGH DETLNNSDSR LGSPNGSLCD SPSPSNDHSP  420
SRSNSKAFNA SPPYRLTSKR TAISRSVEKQ LEFAFDKEKN NHTIKSLESD EISTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-35581555142MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-35581555142MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442548.10.0PREDICTED: myb-related protein A-like
RefseqXP_008442549.10.0PREDICTED: myb-related protein A-like
TrEMBLA0A0A0LA600.0A0A0A0LA60_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g00360.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.18e-75myb domain protein 3r-3